PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AS_61D017632.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 856aa    MW: 94902.4 Da    PI: 6.0694
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AS_61D017632.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.43.9e-195096148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT eEd++l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  Traes_1AS_61D017632.2 50 KGNWTLEEDDILRKAVEIHNGKNWKKIAECFP-DRTDVQCLHRWQKVL 96
                           79******************************.************986 PP

2Myb_DNA-binding56.75.6e-18102148148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+W++eEd+++++ vk++G+  W+tIa+ +  gR +kqc++rw+++l
  Traes_1AS_61D017632.2 102 KGPWSKEEDDIIIQMVKKYGPTKWSTIAQALS-GRIGKQCRERWHNHL 148
                            79******************************.*************97 PP

3Myb_DNA-binding53.65e-17154196145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            +++WT+eE+ +l++a++ +G++ W+  ++ ++ gRt++ +k++w+
  Traes_1AS_61D017632.2 154 KDAWTQEEEIRLIQAHHIYGNK-WAELSKFLP-GRTDNAIKNHWH 196
                            679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0344596IPR017930Myb domain
SMARTSM007172.9E-174998IPR001005SANT/Myb domain
PfamPF002491.6E-165096IPR001005SANT/Myb domain
SuperFamilySSF466893.88E-1651106IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-2452108IPR009057Homeodomain-like
CDDcd001674.39E-155296No hitNo description
PROSITE profilePS5129431.21897152IPR017930Myb domain
SuperFamilySSF466893.13E-3199195IPR009057Homeodomain-like
SMARTSM007174.4E-17101150IPR001005SANT/Myb domain
CDDcd001675.75E-15104148No hitNo description
PfamPF139216.0E-19105165No hitNo description
Gene3DG3DSA:1.10.10.608.2E-26109151IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-21152202IPR009057Homeodomain-like
SMARTSM007171.0E-15153201IPR001005SANT/Myb domain
PROSITE profilePS5129420.671153203IPR017930Myb domain
CDDcd001672.60E-12156196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 856 aa     Download sequence    Send to blast
MTSDKGRTSK KAAEGSPSAL AVPDGRASSG PQKGQLSNGR TTGPARRSTK GNWTLEEDDI  60
LRKAVEIHNG KNWKKIAECF PDRTDVQCLH RWQKVLNPEL VKGPWSKEED DIIIQMVKKY  120
GPTKWSTIAQ ALSGRIGKQC RERWHNHLNP GINKDAWTQE EEIRLIQAHH IYGNKWAELS  180
KFLPGRTDNA IKNHWHSSVK KKYESYRAEG LLAQFQGLPA ALYPTGSLNV DSSSAMMQQN  240
SDGSGLNVNQ EVQDSSEFSQ SALANISSSQ VEQVDEPVGC HGQIHSSDGA HDSYSSCQEA  300
CDTKANDAAS TSPETRHQLS ISENDPDMHW QQDLSVADFD LQSELWQDIS YQSLTAPDSI  360
SADSFFSPNY QHSACSSEVA NNFEEPLYPL HTYSSSRTGT VHHQSSATSV PPSFICSGRA  420
SQIVSSELPI VPESKEQQMT SVEESLPIVP ESKEQQLTSV EESQPLESTT MGREASPNHG  480
KSVVGQKQHS ESLCYEPPCF PSLEVPFVSC ELISSSDLPE YSPLGIRQFM RPSMSFSTPL  540
RLWSSPTRDR SPDDVLKSAA KSSVCTPSIM KKRQREPPSP IPDVRLAKKM GTEKDCGSSA  600
MPSTRTERSC RDATRDDSLD LIPENSKDII YQGKTEDNAN INTLEKRERC STTERDTAYN  660
LVSAGILTDR NGPNPERRKL NTPTKSFSKD IISSRSKPTE LLVEKSSVYI NADYEYVNIL  720
ADTPGIKRGL ESPSAWKSPL FTNFQDGFFM SPTGTTFDAL GLVKQINEQN APALEEAHEL  780
LESGSLCNKE SSDKENIKHI VIKKEHATTN QISNVMSEAR ILDFNECTTP VKKKEDNRCS  840
TLGRSPTSSY VLKNVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-66502026158MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-66502026158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519200.0JF951920.1 Triticum aestivum clone TaMYB35 R1R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231586.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231588.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231587.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLG9DR830.0G9DR83_WHEAT; R1R2R3-MYB protein
STRINGBRADI2G31887.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-104myb domain protein 3r-4
Publications ? help Back to Top
  1. Zhang L,Zhao G,Jia J,Liu X,Kong X
    Molecular characterization of 60 isolated wheat MYB genes and analysis of their expression during abiotic stress.
    J. Exp. Bot., 2012. 63(1): p. 203-14
    [PMID:21934119]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]